PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00042.1.p
Common NameEUGRSUZ_B00042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 807aa    MW: 93751.9 Da    PI: 7.869
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR159.41.1e-1870153390
              FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       Y +YA + GF vrk ++ k+ r+geit+rtf C++eg++ + +++  +++ +r e r+gC a++k k + +g +ev++ ++eHnH+++
  Eucgr.B00042.1.p  70 YVAYAINKGFGVRKGYTVKN-RKGEITRRTFLCNCEGHSVTPSDQ--EKKFERLEVRCGCIAHIKFKVD-NGIYEVIEYVSEHNHAFV 153
                       99**************9999.7788*************9998877..9999*****************9.***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.0E-1670153IPR004330FAR1 DNA binding domain
PfamPF105515.5E-32269363IPR018289MULE transposase domain
PROSITE profilePS509668.568554585IPR007527Zinc finger, SWIM-type
PfamPF044341.3E-4557581IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    Send to blast
MAELEVIFYS YNVKYIFFSF DVIFLIDYLL FIWLQHETSH LAHVMRDMEN DFEFAIGMVF  60
SNELEAYHKY VAYAINKGFG VRKGYTVKNR KGEITRRTFL CNCEGHSVTP SDQEKKFERL  120
EVRCGCIAHI KFKVDNGIYE VIEYVSEHNH AFVSEYQKHL IRCGKMISDT VVVDIIKAGI  180
GGTTAHKFLA NEAGGGSKNL GLCQNFLQTE SNKDVDGRDY QNLLNHFNCM QMQNPMFFYA  240
VQVDQDGRLT NLFWRDSLSK FDYHCFGDVV VFDSTYRINR NNLICAPFVG VNHHWKNTLF  300
GCAFLLDETA ESFTWLFDVF LESMENKAPK TIFTDQDQAM AKAIRRVFPN TQHRLCPWHI  360
IKNANQNIPQ LYHKSGFRDK YFLRLMYRCK SEDEFESTWM EMEEEWGTQN NNWLQRLYGF  420
RHKWSSAFGR DIFSCDIWSS QRSESTNNVF QHISKKTSSL VQFVNYYEEQ LKHMRETEIQ  480
DDYNSRGKPK LQVSYNRILI HAASVYTRII FQKFNEEFLE CLSEQISGTT FDGLIYLYII  540
RCMGNRREHL VRFNPVELSI SCECKLFESK GWLCRHALHV LNKNISVVKS IPSSYILKRW  600
TKGAKEGIVN DESLPPGPSK FDRFATLMQE SFELMILGAK DVNTMQIMME NMKIANGQIS  660
SYKSSIVVTD DAGDDSDNED SLCDISVLDP IRRKGKGISY GKLKSSSEKK KKKSIKGTPP  720
MQIDNRELVF QATHKETHFP NHLSNSNQFQ NIFYPSNIGG PTVNFNNQMQ QPPYIMPLGI  780
MNGFCQFPNQ VLKHFLKSYN HKLQSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1691712RRKGKGISYGKLKSSSEKKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00042.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010025987.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010025992.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A059CXY90.0A0A059CXY9_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-100FAR1-related sequence 5